SCOPe 2.07: Domain d4e38c1: 4e38 C:1-209

Lineage for d4e38c1 (4e38 C:1-209)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.10: Aldolase [51569] (9 families)
   Common fold covers whole protein structure

5. Family c.1.10.0: automated matches [191319] (1 protein)
   not a true family

6. Protein automated matches [190115] (91 species)
   not a true protein

7. Species Vibrionales bacterium [TaxId:391574] [226335] (1 PDB entry)

8. Domain d4e38c1: 4e38 C:1-209 [220229]
   Other proteins in same PDB: d4e38a2, d4e38b2, d4e38c2
   automated match to d1mxsa_
   complexed with cl

Details for d4e38c1

PDB Entry: 4e38, 1.64 Å

PDB Description: Crystal structure of probable keto-hydroxyglutarate-aldolase from Vibrionales bacterium SWAT-3 (Target EFI-502156)

PDB Compounds: (C:) Keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase

SCOPe Domain Sequences for d4e38c1:

Sequence; same for both SEQRES and ATOM records:

>d4e38c1 c.1.10.0 (C:1-209) automated matches {Vibrionales bacterium [TaxId: 391574]}
mstinnqlkalkvipviaidnaediiplgkvlaenglpaaeitfrsdaaveairllrqaq
pemligagtilngeqalaakeagatfvvspgfnpntvracqeigidivpgvnnpstveaa
lemglttlkffpaeasggismvkslvgpygdirlmptggitpsnidnylaipqvlacggt
wmvdkklvtngewdeiarltreiveqvnp

Timeline for d4e38c1:

• d4e38c1 first appeared in SCOPe 2.03, called d4e38c_
  
• d4e38c1 appears in SCOPe 2.06
  
• d4e38c1 appears in the current release, SCOPe 2.08