Lineage for d1mxsa_ (1mxs A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2443024Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2443025Family c.1.10.1: Class I aldolase [51570] (13 proteins)
    the catalytic lysine forms schiff-base intermediate with substrate
    possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels
  6. 2443477Protein KDPG aldolase [51584] (3 species)
  7. 2443498Species Pseudomonas putida [TaxId:303] [102091] (1 PDB entry)
  8. 2443499Domain d1mxsa_: 1mxs A: [91494]
    complexed with so4

Details for d1mxsa_

PDB Entry: 1mxs (more details), 2.2 Å

PDB Description: crystal structure of 2-keto-3-deoxy-6-phosphogluconate (kdpg) aldolase from pseudomonas putida.
PDB Compounds: (A:) kdpg aldolase

SCOPe Domain Sequences for d1mxsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mxsa_ c.1.10.1 (A:) KDPG aldolase {Pseudomonas putida [TaxId: 303]}
lsmadkaaridaicekarilpvitiareedilpladalaaggirtlevtlrsqhglkaiq
vlreqrpelcvgagtvldrsmfaaveaagaqfvvtpgitedileagvdseipllpgistp
seimmgyalgyrrfklfpaeisggvaaikafggpfgdirfcptggvnpanvrnymalpnv
mcvgttwmldsswikngdwarieacsaeaialldan

SCOPe Domain Coordinates for d1mxsa_:

Click to download the PDB-style file with coordinates for d1mxsa_.
(The format of our PDB-style files is described here.)

Timeline for d1mxsa_: