Lineage for d1cf1c1 (1cf1 C:7-182)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 157353Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 160629Family b.1.1.5: E set domains [49208] (27 proteins)
  6. 160630Protein Arrestin [49244] (2 species)
  7. 160640Species Cow (Bos taurus), visual arrestin [TaxId:9913] [49245] (2 PDB entries)
  8. 160645Domain d1cf1c1: 1cf1 C:7-182 [21911]

Details for d1cf1c1

PDB Entry: 1cf1 (more details), 2.8 Å

PDB Description: arrestin from bovine rod outer segments

SCOP Domain Sequences for d1cf1c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cf1c1 b.1.1.5 (C:7-182) Arrestin {Cow (Bos taurus), visual arrestin}
apnhvifkkisrdksvtiylgkrdyidhvervepvdgvvlvdpelvkgkrvyvsltcafr
ygqedidvmglsfrrdlyfsqvqvfppvgasgattrlqeslikklgantypflltfpdyl
pcsvmlqpapqdvgkscgvdfeikafathstdveedkipkkssvrllirkvqhapr

SCOP Domain Coordinates for d1cf1c1:

Click to download the PDB-style file with coordinates for d1cf1c1.
(The format of our PDB-style files is described here.)

Timeline for d1cf1c1: