SCOP 1.63: Domain d1cf1c1: 1cf1 C:7-182

Lineage for d1cf1c1 (1cf1 C:7-182)

Root: SCOP 1.63
Class b: All beta proteins [48724] (119 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.18: E set domains [81296] (17 families)
"Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
Family b.1.18.11: Arrestin [81291] (1 protein)
Protein Arrestin [49244] (2 species)
duplication: contains tandem repeat of two elaborated Ig-like domains contacting each other head-to-head
Species Cow (Bos taurus), visual arrestin [TaxId:9913] [49245] (2 PDB entries)
Domain d1cf1c1: 1cf1 C:7-182 [21911]

Details for d1cf1c1

PDB Entry: 1cf1 (more details), 2.8 Å

PDB Description: arrestin from bovine rod outer segments

SCOP Domain Sequences for d1cf1c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cf1c1 b.1.18.11 (C:7-182) Arrestin {Cow (Bos taurus), visual arrestin}
apnhvifkkisrdksvtiylgkrdyidhvervepvdgvvlvdpelvkgkrvyvsltcafr
ygqedidvmglsfrrdlyfsqvqvfppvgasgattrlqeslikklgantypflltfpdyl
pcsvmlqpapqdvgkscgvdfeikafathstdveedkipkkssvrllirkvqhapr

SCOP Domain Coordinates for d1cf1c1:

Click to download the PDB-style file with coordinates for d1cf1c1.
(The format of our PDB-style files is described here.)

Timeline for d1cf1c1: