Lineage for d4anpa_ (4anp A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1684263Fold d.178: Aromatic aminoacid monoxygenases, catalytic and oligomerization domains [56533] (1 superfamily)
    unusual fold
  4. 1684264Superfamily d.178.1: Aromatic aminoacid monoxygenases, catalytic and oligomerization domains [56534] (1 family) (S)
  5. 1684265Family d.178.1.1: Aromatic aminoacid monoxygenases, catalytic and oligomerization domains [56535] (4 proteins)
  6. 1684307Protein automated matches [191203] (3 species)
    not a true protein
  7. 1684312Species Human (Homo sapiens) [TaxId:9606] [189544] (3 PDB entries)
  8. 1684313Domain d4anpa_: 4anp A: [219081]
    automated match to d1mmka_
    complexed with 3qi, fe

Details for d4anpa_

PDB Entry: 4anp (more details), 2.11 Å

PDB Description: Crystal structure of human phenylalanine hydroxylase in complex with a pharmacological chaperone
PDB Compounds: (A:) phenylalanine-4-hydroxylase

SCOPe Domain Sequences for d4anpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4anpa_ d.178.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tvpwfprtiqeldrfanqilsygaeldadhpgfkdpvyrarrkqfadiaynyrhgqpipr
veymeeekktwgtvfktlkslykthacyeynhifpllekycgfhednipqledvsqflqt
ctgfrlrpvagllssrdflgglafrvfhctqyirhgskpmytpepdichellghvplfsd
rsfaqfsqeiglaslgapdeyieklatiywftvefglckqgdsikaygagllssfgelqy
clsekpkllplelektaiqnytvtefqplyyvaesfndakekvrnfaatiprpfsvrydp
ytqrievld

SCOPe Domain Coordinates for d4anpa_:

Click to download the PDB-style file with coordinates for d4anpa_.
(The format of our PDB-style files is described here.)

Timeline for d4anpa_: