Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.178: Aromatic aminoacid monoxygenases, catalytic and oligomerization domains [56533] (1 superfamily) unusual fold |
Superfamily d.178.1: Aromatic aminoacid monoxygenases, catalytic and oligomerization domains [56534] (1 family) |
Family d.178.1.1: Aromatic aminoacid monoxygenases, catalytic and oligomerization domains [56535] (4 proteins) |
Protein automated matches [191203] (3 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [189544] (3 PDB entries) |
Domain d4anpa_: 4anp A: [219081] automated match to d1mmka_ complexed with 3qi, fe |
PDB Entry: 4anp (more details), 2.11 Å
SCOPe Domain Sequences for d4anpa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4anpa_ d.178.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} tvpwfprtiqeldrfanqilsygaeldadhpgfkdpvyrarrkqfadiaynyrhgqpipr veymeeekktwgtvfktlkslykthacyeynhifpllekycgfhednipqledvsqflqt ctgfrlrpvagllssrdflgglafrvfhctqyirhgskpmytpepdichellghvplfsd rsfaqfsqeiglaslgapdeyieklatiywftvefglckqgdsikaygagllssfgelqy clsekpkllplelektaiqnytvtefqplyyvaesfndakekvrnfaatiprpfsvrydp ytqrievld
Timeline for d4anpa_: