Lineage for d1mmka_ (1mmk A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1684263Fold d.178: Aromatic aminoacid monoxygenases, catalytic and oligomerization domains [56533] (1 superfamily)
    unusual fold
  4. 1684264Superfamily d.178.1: Aromatic aminoacid monoxygenases, catalytic and oligomerization domains [56534] (1 family) (S)
  5. 1684265Family d.178.1.1: Aromatic aminoacid monoxygenases, catalytic and oligomerization domains [56535] (4 proteins)
  6. 1684266Protein Phenylalanine hydroxylase, PAH [56538] (3 species)
  7. 1684277Species Human (Homo sapiens) [TaxId:9606] [56539] (15 PDB entries)
    Uniprot P00439 117-424
  8. 1684283Domain d1mmka_: 1mmk A: [91315]
    complexed with fe2, h4b, so4, tih

Details for d1mmka_

PDB Entry: 1mmk (more details), 2 Å

PDB Description: Crystal structure of ternary complex of the catalytic domain of human phenylalanine hydroxylase ((FeII)) complexed with tetrahydrobiopterin and thienylalanine
PDB Compounds: (A:) phenylalanine-4-hydroxylase

SCOPe Domain Sequences for d1mmka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mmka_ d.178.1.1 (A:) Phenylalanine hydroxylase, PAH {Human (Homo sapiens) [TaxId: 9606]}
tvpwfprtiqeldrfanqilsygaeldadhpgfkdpvyrarrkqfadiaynyrhgqpipr
veymeeekktwgtvfktlkslykthacyeynhifpllekycgfhednipqledvsqflqt
ctgfrlrpvagllssrdflgglafrvfhctqyirhgskpmytpepdichellghvplfsd
rsfaqfsqeiglaslgapdeyieklatiywftvefglckqgdsikaygagllssfgelqy
clsekpkllplelektaiqnytvtefqplyyvaesfndakekvrnfaatiprpfsvrydp
ytqrievld

SCOPe Domain Coordinates for d1mmka_:

Click to download the PDB-style file with coordinates for d1mmka_.
(The format of our PDB-style files is described here.)

Timeline for d1mmka_: