SCOPe 2.05: Domain d4amhb_: 4amh B:

Lineage for d4amhb_ (4amh B:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.36: PDZ domain-like [50155] (1 superfamily)
   contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix

4. Superfamily b.36.1: PDZ domain-like [50156] (7 families)
   peptide-binding domain

5. Family b.36.1.0: automated matches [191362] (1 protein)
   not a true family

6. Protein automated matches [190436] (6 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187333] (84 PDB entries)

8. Domain d4amhb_: 4amh B: [219037]
   automated match to d3rl7b_
   complexed with gol, trs; mutant

Details for d4amhb_

PDB Entry: 4amh, 2.3 Å

PDB Description: influence of circular permutation on the folding pathway of a pdz domain

PDB Compounds: (B:) Disks large homolog 1

SCOPe Domain Sequences for d4amhb_:

Sequence; same for both SEQRES and ATOM records:

>d4amhb_ b.36.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kglgfsiaggvgnqhwpgdnsiyvtkiieggaahkdgklqigdkllavnnvaleevthee
avtalkntsdfvylkvakpgsgekimeiklik

Timeline for d4amhb_:

• d4amhb_ first appeared in SCOPe 2.03
  
• d4amhb_ appears in SCOPe 2.04
  
• d4amhb_ appears in SCOPe 2.06
  
• d4amhb_ appears in the current release, SCOPe 2.08