SCOPe 2.02: Domain d1rhoc_: 1rho C:

Lineage for d1rhoc_ (1rho C:)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (24 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.8: RhoGDI-like [81288] (3 proteins)

6. Protein Rho GDP-dissociation inhibitor 1, RhoGDI [49241] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49242] (11 PDB entries)

8. Domain d1rhoc_: 1rho C: [21901]
   complexed with so4

Details for d1rhoc_

PDB Entry: 1rho, 2.5 Å

PDB Description: structure of rho guanine nucleotide dissociation inhibitor

PDB Compounds: (C:) rho GDP-dissociation inhibitor 1

SCOPe Domain Sequences for d1rhoc_:

Sequence; same for both SEQRES and ATOM records:

>d1rhoc_ b.1.18.8 (C:) Rho GDP-dissociation inhibitor 1, RhoGDI {Human (Homo sapiens) [TaxId: 9606]}
vpnvvvtgltlvcssapgpleldltgdlesfkkqsfvlkegveyrikisfrvnreivsgm
kyiehtyrkgvkidktdymvgsygpraeeyefltpveeapkgmlargsysiksrftdddk
tdhlswewnltikkdwk

Timeline for d1rhoc_:

• d1rhoc_ first appeared (with stable ids) in SCOP 1.55
  
• d1rhoc_ appears in SCOPe 2.01
  
• d1rhoc_ appears in SCOPe 2.03
  
• d1rhoc_ appears in the current release, SCOPe 2.08