Lineage for d1rhoc_ (1rho C:)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) 
Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.5: E set domains [49208] (23 proteins) 
Protein Rho GDP-dissociation inhibitor 1, RhoGDI [49241] (2 species) Species Human (Homo sapiens) [TaxId:9606] [49242] (3 PDB entries) 
Domain d1rhoc_: 1rho C: [21901]
Details for d1rhoc_
PDB Entry: 1rho (more details), 2.5 Å
PDB Description: structure of rho guanine nucleotide dissociation inhibitor
SCOP Domain Sequences for d1rhoc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rhoc_ b.1.1.5 (C:) Rho GDP-dissociation inhibitor 1, RhoGDI {Human (Homo sapiens)}
vpnvvvtgltlvcssapgpleldltgdlesfkkqsfvlkegveyrikisfrvnreivsgm
kyiehtyrkgvkidktdymvgsygpraeeyefltpveeapkgmlargsysiksrftdddk
tdhlswewnltikkdwk
SCOP Domain Coordinates for d1rhoc_:
Click to download the PDB-style file with coordinates for d1rhoc_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1rhoc_:
- d1rhoc_ appears in SCOP 1.57
- d1rhoc_ appears in the current release, SCOPe 2.08
View in 3D
