Lineage for d1efxd2 (1efx D:104-200)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 157353Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 160385Family b.1.1.4: I set domains [49159] (25 proteins)
  6. 160508Protein Killer cell inhibitory receptor [49202] (3 species)
  7. 160514Species Human (Homo sapiens), kir2dl3 [TaxId:9606] [49203] (2 PDB entries)
  8. 160516Domain d1efxd2: 1efx D:104-200 [21794]
    Other proteins in same PDB: d1efxa1, d1efxa2, d1efxb1

Details for d1efxd2

PDB Entry: 1efx (more details), 3 Å

PDB Description: structure of a complex between the human natural killer cell receptor kir2dl2 and a class i mhc ligand hla-cw3

SCOP Domain Sequences for d1efxd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1efxd2 b.1.1.4 (D:104-200) Killer cell inhibitory receptor {Human (Homo sapiens), kir2dl3}
lyekpslsaqpgptvlagesvtlscssrssydmyhlsregeahecrfsagpkvngtfqad
fplgpathggtyrcfgsfrdspyewsnssdpllvsvi

SCOP Domain Coordinates for d1efxd2:

Click to download the PDB-style file with coordinates for d1efxd2.
(The format of our PDB-style files is described here.)

Timeline for d1efxd2: