Lineage for d1efxa1 (1efx A:182-278)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 157353Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 158799Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 158811Protein Class I MHC, beta2-microglobulin and alpha-3 domain [48945] (20 species)
  7. 158960Species Human (Homo sapiens), HLA-CW3 [TaxId:9606] [48955] (1 PDB entry)
  8. 158961Domain d1efxa1: 1efx A:182-278 [20767]
    Other proteins in same PDB: d1efxa2, d1efxd1, d1efxd2, d1efxe1, d1efxe2

Details for d1efxa1

PDB Entry: 1efx (more details), 3 Å

PDB Description: structure of a complex between the human natural killer cell receptor kir2dl2 and a class i mhc ligand hla-cw3

SCOP Domain Sequences for d1efxa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1efxa1 b.1.1.2 (A:182-278) Class I MHC, beta2-microglobulin and alpha-3 domain {Human (Homo sapiens), HLA-CW3}
aehpkthvthhpvsdheatlrcwalgfypaeitltwqwdgedqtqdtelvetrpagdgtf
qkwaavvvpsgeeqrytchvqheglpepltlrwepss

SCOP Domain Coordinates for d1efxa1:

Click to download the PDB-style file with coordinates for d1efxa1.
(The format of our PDB-style files is described here.)

Timeline for d1efxa1: