Class b: All beta proteins [48724] (126 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.4: I set domains [49159] (29 proteins) |
Protein Fc gamma receptor ectodomain (CD32) [49196] (3 species) possibly an intermediate structure between the I set and FnIII domains |
Species Human (Homo sapiens), III [TaxId:9606] [49199] (5 PDB entries) |
Domain d1fnla1: 1fnl A:3-86 [21783] |
PDB Entry: 1fnl (more details), 1.8 Å
SCOP Domain Sequences for d1fnla1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fnla1 b.1.1.4 (A:3-86) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), III} edlpkavvflepqwysvlekdsvtlkcqgayspednstqwfhneslissqassyfidaat vndsgeyrcqtnlstlsdpvqlev
Timeline for d1fnla1: