Lineage for d1fnla1 (1fnl A:3-86)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 9408Family b.1.1.4: I set domains [49159] (21 proteins)
  6. 9415Protein Fc gamma receptor ectodomain (CD32) [49196] (3 species)
  7. 9422Species Human (Homo sapiens), III [TaxId:9606] [49199] (3 PDB entries)
  8. 9423Domain d1fnla1: 1fnl A:3-86 [21783]

Details for d1fnla1

PDB Entry: 1fnl (more details), 1.8 Å

PDB Description: crystal structure of the extracellular domain of a human fcgriii

SCOP Domain Sequences for d1fnla1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fnla1 b.1.1.4 (A:3-86) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), III}
edlpkavvflepqwysvlekdsvtlkcqgayspednstqwfhneslissqassyfidaat
vndsgeyrcqtnlstlsdpvqlev

SCOP Domain Coordinates for d1fnla1:

Click to download the PDB-style file with coordinates for d1fnla1.
(The format of our PDB-style files is described here.)

Timeline for d1fnla1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1fnla2