Lineage for d1qtyx_ (1qty X:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 362615Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 362616Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 366356Family b.1.1.4: I set domains [49159] (32 proteins)
  6. 366598Protein Second domain of the Flt-1 receptor [49188] (1 species)
  7. 366599Species Human (Homo sapiens) [TaxId:9606] [49189] (5 PDB entries)
  8. 366606Domain d1qtyx_: 1qty X: [21767]
    Other proteins in same PDB: d1qtyr_, d1qtys_, d1qtyv_, d1qtyw_

Details for d1qtyx_

PDB Entry: 1qty (more details), 2.7 Å

PDB Description: vascular endothelial growth factor in complex with domain 2 of the flt-1 receptor

SCOP Domain Sequences for d1qtyx_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qtyx_ b.1.1.4 (X:) Second domain of the Flt-1 receptor {Human (Homo sapiens)}
grpfvemyseipeiihmtegrelvipcrvtspnitvtlkkfpldtlipdgkriiwdsrkg
fiisnatykeiglltceatvnghlyktnylthrq

SCOP Domain Coordinates for d1qtyx_:

Click to download the PDB-style file with coordinates for d1qtyx_.
(The format of our PDB-style files is described here.)

Timeline for d1qtyx_: