Class b: All beta proteins [48724] (126 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.4: I set domains [49159] (29 proteins) |
Protein Second domain of the Flt-1 receptor [49188] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [49189] (4 PDB entries) |
Domain d1qtyx_: 1qty X: [21767] Other proteins in same PDB: d1qtyr_, d1qtys_, d1qtyv_, d1qtyw_ |
PDB Entry: 1qty (more details), 2.7 Å
SCOP Domain Sequences for d1qtyx_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qtyx_ b.1.1.4 (X:) Second domain of the Flt-1 receptor {Human (Homo sapiens)} grpfvemyseipeiihmtegrelvipcrvtspnitvtlkkfpldtlipdgkriiwdsrkg fiisnatykeiglltceatvnghlyktnylthrq
Timeline for d1qtyx_: