Lineage for d3v1ma_ (3v1m A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2150568Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2150569Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2151357Family c.69.1.10: Carbon-carbon bond hydrolase [53522] (3 proteins)
    closely related to the Proline iminopeptidase-like family
  6. 2151358Protein 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) [53523] (2 species)
  7. 2151359Species Burkholderia xenovorans [TaxId:36873] [159736] (13 PDB entries)
    Uniprot P47229 4-286
  8. 2151368Domain d3v1ma_: 3v1m A: [217595]
    automated match to d3v1la_
    complexed with hpk, mli; mutant

Details for d3v1ma_

PDB Entry: 3v1m (more details), 1.92 Å

PDB Description: crystal structure of the s112a/h265q mutant of a c-c hydrolase, bphd from burkholderia xenovorans lb400, after exposure to its substrate hopda
PDB Compounds: (A:) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase

SCOPe Domain Sequences for d3v1ma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3v1ma_ c.69.1.10 (A:) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Burkholderia xenovorans [TaxId: 36873]}
ltesstskfvkinekgfsdfnihyneagngetvimlhgggpgaggwsnyyrnvgpfvdag
yrvilkdspgfnksdavvmdeqrglvnaravkglmdaldidrahlvgnamggatalnfal
eypdrigklilmgpgglgpsmfapmpmegikllfklyaepsyetlkqmlqvflydqslit
eellqgrweaiqrqpehlknflisaqkaplstwdvtarlgeikaktfitwgrddrfvpld
hglkllwniddarlhvfskcgqwaqwehadefnrlvidflrha

SCOPe Domain Coordinates for d3v1ma_:

Click to download the PDB-style file with coordinates for d3v1ma_.
(The format of our PDB-style files is described here.)

Timeline for d3v1ma_: