![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
![]() | Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
![]() | Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
![]() | Protein automated matches [190056] (195 species) not a true protein |
![]() | Species Rhizobium meliloti (Sinorhizobium meliloti) [TaxId:382] [226257] (1 PDB entry) |
![]() | Domain d3umac1: 3uma C:1-161 [217443] Other proteins in same PDB: d3umaa2, d3umac2 automated match to d4f82b_ complexed with so4 |
PDB Entry: 3uma (more details), 2.2 Å
SCOPe Domain Sequences for d3umac1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3umac1 c.47.1.0 (C:1-161) automated matches {Rhizobium meliloti (Sinorhizobium meliloti) [TaxId: 382]} mtiavgdklpnatfkektadgpvevttellfkgkrvvlfavpgaftptcslnhlpgylen rdailargvddiavvavndlhvmgawathsggmgkihflsdwnaaftkaigmeidlsagt lgirskrysmlvedgvvkalnieespgqatasgaaamlell
Timeline for d3umac1: