Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
Protein automated matches [190056] (107 species) not a true protein |
Species Rhizobium meliloti (Sinorhizobium meliloti) [TaxId:382] [226257] (1 PDB entry) |
Domain d3umac_: 3uma C: [217443] automated match to d4f82b_ complexed with so4 |
PDB Entry: 3uma (more details), 2.2 Å
SCOPe Domain Sequences for d3umac_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3umac_ c.47.1.0 (C:) automated matches {Rhizobium meliloti (Sinorhizobium meliloti) [TaxId: 382]} nlyfqsmmtiavgdklpnatfkektadgpvevttellfkgkrvvlfavpgaftptcslnh lpgylenrdailargvddiavvavndlhvmgawathsggmgkihflsdwnaaftkaigme idlsagtlgirskrysmlvedgvvkalnieespgqatasgaaamlell
Timeline for d3umac_: