![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
![]() | Protein automated matches [190740] (19 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187920] (522 PDB entries) |
![]() | Domain d3u30b1: 3u30 B:1-107 [217163] Other proteins in same PDB: d3u30a1, d3u30a2, d3u30b2, d3u30d1, d3u30d2, d3u30e2 automated match to d1rhha1 |
PDB Entry: 3u30 (more details), 2.43 Å
SCOPe Domain Sequences for d3u30b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3u30b1 b.1.1.0 (B:1-107) automated matches {Human (Homo sapiens) [TaxId: 9606]} diqmtqspsslsasvgdrvtitcrasqdvstavawyqqkpgkapklliysakflysgvps rfsgsgsgtdftltisslqpedfatyycqqsyttpptfgqgtkveik
Timeline for d3u30b1: