SCOPe 2.04: Domain d1rhha1: 1rhh A:1-106A

Lineage for d1rhha1 (1rhh A:1-106A)

Root: SCOPe 2.04
Class b: All beta proteins [48724] (176 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

Species Human (Homo sapiens), cluster 3.2 [TaxId:9606] [88523] (31 PDB entries)
Domain d1rhha1: 1rhh A:1-106A [97473]
Other proteins in same PDB: d1rhha2, d1rhhb1, d1rhhb2, d1rhhc2, d1rhhd1, d1rhhd2
part of HIV-1 neutralizing Fab x5

Details for d1rhha1

PDB Entry: 1rhh (more details), 1.9 Å

PDB Description: Crystal Structure of the Broadly HIV-1 Neutralizing Fab X5 at 1.90 Angstrom Resolution

PDB Compounds: (A:) Fab X5, light chain

SCOPe Domain Sequences for d1rhha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rhha1 b.1.1.1 (A:1-106A) Immunoglobulin light chain kappa variable domain, VL-kappa {Human (Homo sapiens), cluster 3.2 [TaxId: 9606]}
elvltqspgtlslsageratlscrasqsvssgslawyqqkpgqaprlliygastratgip
drfsgsgsgtdftltigrlepedlavyycqqygtspytfgqgtkleik

SCOPe Domain Coordinates for d1rhha1:

Click to download the PDB-style file with coordinates for d1rhha1.
(The format of our PDB-style files is described here.)

Timeline for d1rhha1: