SCOPe 2.05: Domain d3u17b_: 3u17 B:

Lineage for d3u17b_ (3u17 B:)

1. Root: SCOPe 2.05

2. Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)

3. Fold e.23: Acetyl-CoA synthetase-like [56800] (1 superfamily)
   4 domains: (1&2) duplication: share the same alpha/beta fold; (3) beta-barrel; (4) alpha+beta

4. Superfamily e.23.1: Acetyl-CoA synthetase-like [56801] (2 families)

5. Family e.23.1.0: automated matches [191594] (1 protein)
   not a true family

6. Protein automated matches [191083] (15 species)
   not a true protein

7. Species Acinetobacter baumannii [TaxId:557601] [189484] (5 PDB entries)

8. Domain d3u17b_: 3u17 B: [217142]
   automated match to d3o83b_
   complexed with ca, h90, mpd, mrd

Details for d3u17b_

PDB Entry: 3u17, 2.1 Å

PDB Description: structure of base n-terminal domain from acinetobacter baumannii bound to 6-(p-benzoyl)phenyl-1-(pyridin-4-ylmethyl)-1h-pyrazolo[3,4- b]pyridine-4-carboxylic acid

PDB Compounds: (B:) Peptide arylation enzyme

SCOPe Domain Sequences for d3u17b_:

Sequence; same for both SEQRES and ATOM records:

>d3u17b_ e.23.1.0 (B:) automated matches {Acinetobacter baumannii [TaxId: 557601]}
kqliefvrwsperaqhyrnkgywidqpltriltvgvqshphslaiicgerqlsyieldrl
stnlatrlaekglgkgdtalvqlpnvaefyivffallkagvvvlnalyshrqyelnafik
qiqpklligsrqhevfsnnqfidslhdvnlspeiilmlnhqatdfglldwietpaetfvd
fsstpadevaffqlsggstgtpkliprthndydysvrasaeicglnsntrllcalpaphn
fmlsspgalgvlhaggcvvmapnpeplncfsiiqrhqvnmaslvpsavimwlekaaqykd
qiqslkllqvggasfpeslarqvpevlncklqqvfgmaeglvnytrlddsdeqifttqgr
pissddeikivdeqyrevpegeigmlatrgpytfcgyyqspehnsqvfdednyyysgdlv
qrtpdgnlrvvgrikd

Timeline for d3u17b_:

• d3u17b_ first appeared in SCOPe 2.03
  
• d3u17b_ appears in SCOPe 2.04
  
• d3u17b_ appears in SCOPe 2.06
  
• d3u17b_ appears in the current release, SCOPe 2.08