SCOP 1.65: Domain d1epfd1: 1epf D:-1-97

Lineage for d1epfd1 (1epf D:-1-97)

Root: SCOP 1.65
Class b: All beta proteins [48724] (126 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (4 families)
Family b.1.1.4: I set domains [49159] (29 proteins)
Protein Neural cell adhesion molecule (NCAM) [49166] (2 species)
Species Rat (Rattus norvegicus) [TaxId:10116] [49167] (3 PDB entries)
Rat and mouse sequences are identical for the two N-terminal modules
Domain d1epfd1: 1epf D:-1-97 [21700]

Details for d1epfd1

PDB Entry: 1epf (more details), 1.85 Å

PDB Description: crystal structure of the two n-terminal immunoglobulin domains of the neural cell adhesion molecule (ncam)

SCOP Domain Sequences for d1epfd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1epfd1 b.1.1.4 (D:-1-97) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus)}
rvlqvdivpsqgeisvgeskfflcqvagdakdkdiswfspngeklspnqqrisvvwnddd
sstltiynaniddagiykcvvtaedgtqseatvnvkifq

SCOP Domain Coordinates for d1epfd1:

Click to download the PDB-style file with coordinates for d1epfd1.
(The format of our PDB-style files is described here.)

Timeline for d1epfd1: