Lineage for d1vsca2 (1vsc A:1-90)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1764414Family b.1.1.4: I set domains [49159] (39 proteins)
  6. 1764801Protein Vascular cell adhesion molecule-1 (VCAM-1) [49160] (1 species)
  7. 1764802Species Human (Homo sapiens) [TaxId:9606] [49161] (3 PDB entries)
  8. 1764805Domain d1vsca2: 1vsc A:1-90 [21687]
    Other proteins in same PDB: d1vsca1, d1vscb1
    D1

Details for d1vsca2

PDB Entry: 1vsc (more details), 1.9 Å

PDB Description: vcam-1
PDB Compounds: (A:) vascular cell adhesion molecule-1

SCOPe Domain Sequences for d1vsca2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vsca2 b.1.1.4 (A:1-90) Vascular cell adhesion molecule-1 (VCAM-1) {Human (Homo sapiens) [TaxId: 9606]}
fkiettpesrylaqigdsvsltcsttgcespffswrtqidsplngkvtnegttstltmnp
vsfgnehsylctatcesrklekgiqveiys

SCOPe Domain Coordinates for d1vsca2:

Click to download the PDB-style file with coordinates for d1vsca2.
(The format of our PDB-style files is described here.)

Timeline for d1vsca2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1vsca1