![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.3: C2 set domains [49142] (8 proteins) |
![]() | Protein Vascular cell adhesion molecule-1 (VCAM-1) [49143] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [49144] (3 PDB entries) |
![]() | Domain d1vsca1: 1vsc A:91-196 [21651] Other proteins in same PDB: d1vsca2, d1vscb2 D2 |
PDB Entry: 1vsc (more details), 1.9 Å
SCOPe Domain Sequences for d1vsca1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vsca1 b.1.1.3 (A:91-196) Vascular cell adhesion molecule-1 (VCAM-1) {Human (Homo sapiens) [TaxId: 9606]} fpkdpeihlsgpleagkpitvkcsvadvypfdrleidllkgdhlmksqefledadrksle tkslevtftpviedigkvlvcraklhidemdsvptvrqavkelqvd
Timeline for d1vsca1: