Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds) |
Fold e.8: DNA/RNA polymerases [56671] (1 superfamily) divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members |
Superfamily e.8.1: DNA/RNA polymerases [56672] (7 families) "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain |
Family e.8.1.4: RNA-dependent RNA-polymerase [56694] (3 proteins) |
Protein automated matches [190260] (29 species) not a true protein |
Species Murine norovirus 1 [TaxId:223997] [189982] (8 PDB entries) |
Domain d3sfub_: 3sfu B: [216385] automated match to d3naha_ protein/RNA complex; complexed with gol, mg, rbv, so4 |
PDB Entry: 3sfu (more details), 2.5 Å
SCOPe Domain Sequences for d3sfub_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3sfub_ e.8.1.4 (B:) automated matches {Murine norovirus 1 [TaxId: 223997]} lprpsgtyaglpiadygdapplstktmfwrtspeklppgawepaylgskdervdgpslqq vmrdqlkpyseprgllppqeildavcdaienrlentlepqkpwtfkkacesldkntssgy pyhkqkskdwtgsafigdlgdqathannmyemgksmrpiytaalkdelvkpdkiygkikk rllwgsdlgtmiraarafgpfcdalketcifnpirvgmsmnedgpfifarhanfryhmda dytrwdstqqrailkragdimvrlspepdlarvvmddllapslldvgdykivveeglpsg cpcttqlnslahwiltlcamvevtrvdpdivmqesefsfygddevvstnleldmvkytma lrrygllptradkeegplerrqtlqgisflrraivgdqfgwygrldrasidrqllwtkgp nhqnpfetlpghaqrpsqlmallgeaamhgekyyrtvasrvskeaaqsgiemvvprhrsv lrwvrfg
Timeline for d3sfub_: