SCOPe 2.06: Domain d3sfub_: 3sfu B:

Lineage for d3sfub_ (3sfu B:)

1. Root: SCOPe 2.06

2. Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)

3. Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
   divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members

4. Superfamily e.8.1: DNA/RNA polymerases [56672] (7 families)
   "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain

5. Family e.8.1.4: RNA-dependent RNA-polymerase [56694] (3 proteins)

6. Protein automated matches [190260] (29 species)
   not a true protein

7. Species Murine norovirus 1 [TaxId:223997] [189982] (8 PDB entries)

8. Domain d3sfub_: 3sfu B: [216385]
   automated match to d3naha_
   protein/RNA complex; complexed with gol, mg, rbv, so4

Details for d3sfub_

PDB Entry: 3sfu, 2.5 Å

PDB Description: crystal structure of murine norovirus RNA dependent RNA polymerase in complex with ribavirin

PDB Compounds: (B:) RNA polymerase

SCOPe Domain Sequences for d3sfub_:

Sequence; same for both SEQRES and ATOM records:

>d3sfub_ e.8.1.4 (B:) automated matches {Murine norovirus 1 [TaxId: 223997]}
lprpsgtyaglpiadygdapplstktmfwrtspeklppgawepaylgskdervdgpslqq
vmrdqlkpyseprgllppqeildavcdaienrlentlepqkpwtfkkacesldkntssgy
pyhkqkskdwtgsafigdlgdqathannmyemgksmrpiytaalkdelvkpdkiygkikk
rllwgsdlgtmiraarafgpfcdalketcifnpirvgmsmnedgpfifarhanfryhmda
dytrwdstqqrailkragdimvrlspepdlarvvmddllapslldvgdykivveeglpsg
cpcttqlnslahwiltlcamvevtrvdpdivmqesefsfygddevvstnleldmvkytma
lrrygllptradkeegplerrqtlqgisflrraivgdqfgwygrldrasidrqllwtkgp
nhqnpfetlpghaqrpsqlmallgeaamhgekyyrtvasrvskeaaqsgiemvvprhrsv
lrwvrfg

Timeline for d3sfub_:

• d3sfub_ first appeared in SCOPe 2.03
  
• d3sfub_ appears in SCOPe 2.05
  
• d3sfub_ appears in SCOPe 2.07
  
• d3sfub_ appears in the current release, SCOPe 2.08