SCOPe 2.06: Domain d3sbcb1: 3sbc B:0-195

Lineage for d3sbcb1 (3sbc B:0-195)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins)

6. Protein automated matches [190100] (19 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [226432] (2 PDB entries)

8. Domain d3sbcb1: 3sbc B:0-195 [216268]
   Other proteins in same PDB: d3sbca_, d3sbcb2, d3sbcc_, d3sbcd_, d3sbce_, d3sbcf_, d3sbcg_, d3sbch_, d3sbci_, d3sbcj_
   automated match to d1qmva_
   complexed with dtu, dtv; mutant

Details for d3sbcb1

PDB Entry: 3sbc, 2.8 Å

PDB Description: Crystal structure of Saccharomyces cerevisiae TSA1C47S mutant protein

PDB Compounds: (B:) Peroxiredoxin TSA1

SCOPe Domain Sequences for d3sbcb1:

Sequence; same for both SEQRES and ATOM records:

>d3sbcb1 c.47.1.10 (B:0-195) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mvaqvqkqaptfkktavvdgvfdevsldkykgkyvvlafiplaftfvspteiiafseaak
kfeeqgaqvlfastdseysllawtniprkegglgpiniplladtnhslsrdygvlieeeg
valrglfiidpkgvirhitindlpvgrnvdealrlveafqwtdkngtvlpcnwtpgaati
kptvedskeyfeaank

Timeline for d3sbcb1:

• d3sbcb1 first appeared in SCOPe 2.03, called d3sbcb_
  
• d3sbcb1 was called d3sbcb_ in SCOPe 2.05
  
• d3sbcb1 appears in SCOPe 2.07
  
• d3sbcb1 appears in the current release, SCOPe 2.08