Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins) |
Protein automated matches [190100] (15 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [226432] (1 PDB entry) |
Domain d3sbcb_: 3sbc B: [216268] Other proteins in same PDB: d3sbca_, d3sbcc_, d3sbcd_, d3sbce_, d3sbcf_, d3sbcg_, d3sbch_, d3sbci_, d3sbcj_ automated match to d1qmva_ complexed with dtu, dtv; mutant |
PDB Entry: 3sbc (more details), 2.8 Å
SCOPe Domain Sequences for d3sbcb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3sbcb_ c.47.1.10 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} hmvaqvqkqaptfkktavvdgvfdevsldkykgkyvvlafiplaftfvspteiiafseaa kkfeeqgaqvlfastdseysllawtniprkegglgpiniplladtnhslsrdygvlieee gvalrglfiidpkgvirhitindlpvgrnvdealrlveafqwtdkngtvlpcnwtpgaat ikptvedskeyfeaank
Timeline for d3sbcb_: