Lineage for d3sbcb_ (3sbc B:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1368269Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1368270Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1369372Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins)
  6. 1369704Protein automated matches [190100] (15 species)
    not a true protein
  7. 1369842Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [226432] (1 PDB entry)
  8. 1369843Domain d3sbcb_: 3sbc B: [216268]
    Other proteins in same PDB: d3sbca_, d3sbcc_, d3sbcd_, d3sbce_, d3sbcf_, d3sbcg_, d3sbch_, d3sbci_, d3sbcj_
    automated match to d1qmva_
    complexed with dtu, dtv; mutant

Details for d3sbcb_

PDB Entry: 3sbc (more details), 2.8 Å

PDB Description: Crystal structure of Saccharomyces cerevisiae TSA1C47S mutant protein
PDB Compounds: (B:) Peroxiredoxin TSA1

SCOPe Domain Sequences for d3sbcb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3sbcb_ c.47.1.10 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
hmvaqvqkqaptfkktavvdgvfdevsldkykgkyvvlafiplaftfvspteiiafseaa
kkfeeqgaqvlfastdseysllawtniprkegglgpiniplladtnhslsrdygvlieee
gvalrglfiidpkgvirhitindlpvgrnvdealrlveafqwtdkngtvlpcnwtpgaat
ikptvedskeyfeaank

SCOPe Domain Coordinates for d3sbcb_:

Click to download the PDB-style file with coordinates for d3sbcb_.
(The format of our PDB-style files is described here.)

Timeline for d3sbcb_: