Lineage for d3s14k_ (3s14 K:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1656918Fold d.74: DCoH-like [55247] (5 superfamilies)
    beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta
  4. 1657041Superfamily d.74.3: RBP11-like subunits of RNA polymerase [55257] (3 families) (S)
    form homo and heterodimers
  5. 1657142Family d.74.3.2: RBP11/RpoL [64311] (3 proteins)
  6. 1657149Protein RPB11 [64312] (2 species)
  7. 1657175Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [224934] (1 PDB entry)
  8. 1657176Domain d3s14k_: 3s14 K: [216153]
    Other proteins in same PDB: d3s14a_, d3s14b_, d3s14c1, d3s14c2, d3s14e1, d3s14e2, d3s14f_, d3s14h_, d3s14i1, d3s14i2, d3s14j_, d3s14l_
    automated match to d1twfk_
    protein/DNA complex; protein/RNA complex; complexed with mg, zn

Details for d3s14k_

PDB Entry: 3s14 (more details), 2.85 Å

PDB Description: rna polymerase ii initiation complex with a 6-nt rna
PDB Compounds: (K:) DNA-directed RNA polymerase II subunit RPB11

SCOPe Domain Sequences for d3s14k_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3s14k_ d.74.3.2 (K:) RPB11 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
mnapdrfelfllgegesklkidpdtkapnavvitfekedhtlgnliraellndrkvlfaa
ykvehpffarfklriqttegydpkdalknacnsiinklgalktnfetewnlqtl

SCOPe Domain Coordinates for d3s14k_:

Click to download the PDB-style file with coordinates for d3s14k_.
(The format of our PDB-style files is described here.)

Timeline for d3s14k_: