Lineage for d3s14i1 (3s14 I:2-49)

  1. Root: SCOPe 2.04
  2. 1700111Class g: Small proteins [56992] (91 folds)
  3. 1705786Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 1705857Superfamily g.41.3: Zinc beta-ribbon [57783] (5 families) (S)
  5. 1705858Family g.41.3.1: Transcriptional factor domain [57784] (5 proteins)
  6. 1705859Protein RBP9 subunit of RNA polymerase II [57787] (3 species)
    contains two differently decorated domains of this fold
  7. 1705911Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [224953] (1 PDB entry)
  8. 1705912Domain d3s14i1: 3s14 I:2-49 [216150]
    Other proteins in same PDB: d3s14a_, d3s14b_, d3s14c1, d3s14c2, d3s14e1, d3s14e2, d3s14f_, d3s14h_, d3s14j_, d3s14k_, d3s14l_
    automated match to d1twfi1
    protein/DNA complex; protein/RNA complex; complexed with mg, zn

Details for d3s14i1

PDB Entry: 3s14 (more details), 2.85 Å

PDB Description: rna polymerase ii initiation complex with a 6-nt rna
PDB Compounds: (I:) DNA-directed RNA polymerase II subunit RPB9

SCOPe Domain Sequences for d3s14i1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3s14i1 g.41.3.1 (I:2-49) RBP9 subunit of RNA polymerase II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
ttfrfcrdcnnmlypredkennrllfecrtcsyveeagsplvyrheli

SCOPe Domain Coordinates for d3s14i1:

Click to download the PDB-style file with coordinates for d3s14i1.
(The format of our PDB-style files is described here.)

Timeline for d3s14i1: