Lineage for d3s14j_ (3s14 J:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1477565Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1480666Superfamily a.4.11: RNA polymerase subunit RPB10 [46924] (1 family) (S)
    automatically mapped to Pfam PF01194
  5. 1480667Family a.4.11.1: RNA polymerase subunit RPB10 [46925] (2 proteins)
    Zn-binding site is near the N-terminus
  6. 1480668Protein RNA polymerase subunit RPB10 [46926] (3 species)
  7. 1480700Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [224845] (1 PDB entry)
  8. 1480701Domain d3s14j_: 3s14 J: [216152]
    Other proteins in same PDB: d3s14a_, d3s14b_, d3s14c1, d3s14c2, d3s14e1, d3s14e2, d3s14f_, d3s14h_, d3s14i1, d3s14i2, d3s14k_, d3s14l_
    automated match to d1twfj_
    protein/DNA complex; protein/RNA complex; complexed with mg, zn

Details for d3s14j_

PDB Entry: 3s14 (more details), 2.85 Å

PDB Description: rna polymerase ii initiation complex with a 6-nt rna
PDB Compounds: (J:) DNA-directed RNA polymerases I, II, and III subunit RPABC5

SCOPe Domain Sequences for d3s14j_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3s14j_ a.4.11.1 (J:) RNA polymerase subunit RPB10 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
mivpvrcfscgkvvgdkwesylnllqedeldegtalsrlglkryccrrmilthvdliekf
lrynp

SCOPe Domain Coordinates for d3s14j_:

Click to download the PDB-style file with coordinates for d3s14j_.
(The format of our PDB-style files is described here.)

Timeline for d3s14j_: