![]() | Class b: All beta proteins [48724] (126 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins) |
![]() | Protein Class II MHC beta chain, C-terminal domain [88625] (6 species) |
![]() | Species Human (Homo sapiens), HLA-DR group [TaxId:9606] [88628] (23 PDB entries) probably orthologous to the mouse I-E group |
![]() | Domain d1bx2e1: 1bx2 E:93-191 [21612] Other proteins in same PDB: d1bx2a1, d1bx2a2, d1bx2b2, d1bx2d1, d1bx2d2, d1bx2e2 complexed with nag |
PDB Entry: 1bx2 (more details), 2.6 Å
SCOP Domain Sequences for d1bx2e1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bx2e1 b.1.1.2 (E:93-191) Class II MHC beta chain, C-terminal domain {Human (Homo sapiens), HLA-DR group} rrvqpkvtvypsktqplqhhnllvcsvsgfypgsievrwflngqeekagmvstgliqngd wtfqtlvmletvprsgevytcqvehpsvtspltvewrar
Timeline for d1bx2e1: