SCOPe 2.06: Domain d3regb_: 3reg B:

Lineage for d3regb_ (3reg B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (79 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein automated matches [190047] (29 species)
   not a true protein

7. Species Entamoeba (Entamoeba histolytica) [TaxId:5759] [196360] (4 PDB entries)

8. Domain d3regb_: 3reg B: [215775]
   automated match to d1hh4a_
   complexed with gsp, mg

Details for d3regb_

PDB Entry: 3reg, 1.8 Å

PDB Description: Crystal structure of EhRho1 bound to a GTP analog and Magnesium

PDB Compounds: (B:) Rho-like small GTPase

SCOPe Domain Sequences for d3regb_:

Sequence; same for both SEQRES and ATOM records:

>d3regb_ c.37.1.8 (B:) automated matches {Entamoeba (Entamoeba histolytica) [TaxId: 5759]}
kkalkivvvgdgavgktclllafskgeiptayvptvfenfshvmkykneefilhlwdtag
qeeydrlrplsyadsdvvllcfavnnrtsfdnistkwepeikhyidtaktvlvglkvdlr
kdgsddvtkqegddlcqklgcvayieassvakiglnevfeksvdcifs

Timeline for d3regb_:

• d3regb_ first appeared in SCOPe 2.03
  
• d3regb_ appears in SCOPe 2.05
  
• d3regb_ appears in SCOPe 2.07
  
• d3regb_ appears in the current release, SCOPe 2.08