Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) division into families based on beta-sheet topologies |
Family c.37.1.8: G proteins [52592] (80 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
Protein automated matches [190047] (34 species) not a true protein |
Species Entamoeba (Entamoeba histolytica) [TaxId:5759] [196360] (4 PDB entries) |
Domain d3regb_: 3reg B: [215775] automated match to d1hh4a_ complexed with gsp, mg |
PDB Entry: 3reg (more details), 1.8 Å
SCOPe Domain Sequences for d3regb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3regb_ c.37.1.8 (B:) automated matches {Entamoeba (Entamoeba histolytica) [TaxId: 5759]} kkalkivvvgdgavgktclllafskgeiptayvptvfenfshvmkykneefilhlwdtag qeeydrlrplsyadsdvvllcfavnnrtsfdnistkwepeikhyidtaktvlvglkvdlr kdgsddvtkqegddlcqklgcvayieassvakiglnevfeksvdcifs
Timeline for d3regb_: