Lineage for d3r6se1 (3r6s E:3-147)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2080271Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2082002Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families) (S)
  5. 2082241Family b.82.3.0: automated matches [227198] (1 protein)
    not a true family
  6. 2082242Protein automated matches [226927] (14 species)
    not a true protein
  7. 2082253Species Corynebacterium glutamicum [TaxId:1718] [226339] (2 PDB entries)
  8. 2082258Domain d3r6se1: 3r6s E:3-147 [215605]
    Other proteins in same PDB: d3r6sa2, d3r6sb2, d3r6sc2, d3r6sd2, d3r6se2, d3r6sf2
    automated match to d1g6na2
    complexed with cmp, hez

Details for d3r6se1

PDB Entry: 3r6s (more details), 2.38 Å

PDB Description: Crystal structure of GlxR transcription factor from Corynebacterium glutamicum with cAMP
PDB Compounds: (E:) Transcription regulator

SCOPe Domain Sequences for d3r6se1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3r6se1 b.82.3.0 (E:3-147) automated matches {Corynebacterium glutamicum [TaxId: 1718]}
gvqeilsragifqgvdptavnnliqdmetvrfprgatifdegepgdrlyiitsgkvklar
hapdgrenlltimgpsdmfgelsifdpgprtssavcvtevhaatmnsdmlrnwvadhpai
aeqllrvlarrlrrtnasladlift

SCOPe Domain Coordinates for d3r6se1:

Click to download the PDB-style file with coordinates for d3r6se1.
(The format of our PDB-style files is described here.)

Timeline for d3r6se1: