Class a: All alpha proteins [46456] (290 folds) |
Fold a.16: S15/NS1 RNA-binding domain [47059] (1 superfamily) 3 helices; irregular array |
Superfamily a.16.1: S15/NS1 RNA-binding domain [47060] (4 families) |
Family a.16.1.1: N-terminal, RNA-binding domain of nonstructural protein NS1 [47061] (2 proteins) |
Protein N-terminal, RNA-binding domain of nonstructural protein NS1 [47062] (4 species) |
Species Influenza B virus [TaxId:11520] [140389] (4 PDB entries) Uniprot P03502 15-103 |
Domain d3r66b_: 3r66 B: [215595] Other proteins in same PDB: d3r66c1, d3r66c2, d3r66d1, d3r66d2 automated match to d3rt3c_ |
PDB Entry: 3r66 (more details), 2.3 Å
SCOPe Domain Sequences for d3r66b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3r66b_ a.16.1.1 (B:) N-terminal, RNA-binding domain of nonstructural protein NS1 {Influenza B virus [TaxId: 11520]} ttqievgpgatnatinfeagilecyerfswqraldypgqdrlhrlkrklesrikthnkse penkrmsleerkaigvkmmkvllfmdpsagiegfep
Timeline for d3r66b_: