PDB entry 3r66

View 3r66 on RCSB PDB site
Description: Crystal structure of human ISG15 in complex with NS1 N-terminal region from influenza virus B, Northeast Structural Genomics Consortium Target IDs HX6481, HR2873, and OR2
Class: viral protein/antiviral protein
Keywords: Structural Genomics, PSI-Biology, Northeast Structural Genomics Consortium, NESG, innate immunity, ISG15 conjugation, viral protein-antiviral protein complex
Deposited on 2011-03-21, released 2011-06-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Non-structural protein 1
    Species: Influenza B virus [TaxId:107412]
    Gene: NS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3r66a_
  • Chain 'B':
    Compound: Non-structural protein 1
    Species: Influenza B virus [TaxId:107412]
    Gene: NS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3r66b_
  • Chain 'C':
    Compound: Ubiquitin-like protein ISG15
    Species: Homo sapiens [TaxId:9606]
    Gene: ISG15, G1P2, UCRP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3r66c1, d3r66c2
  • Chain 'D':
    Compound: Ubiquitin-like protein ISG15
    Species: Homo sapiens [TaxId:9606]
    Gene: ISG15, G1P2, UCRP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3r66d1, d3r66d2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3r66A (A:)
    mghhhhhhshmadnmtttqievgpgatnatinfeagilecyerfswqraldypgqdrlhr
    lkrklesrikthnksepenkrmsleerkaigvkmmkvllfmdpsagiegfepy
    

    Sequence, based on observed residues (ATOM records): (download)
    >3r66A (A:)
    ttqievgpgatnatinfeagilecyerfswqraldypgqdrlhrlkrklesrikthnkse
    penkrmsleerkaigvkmmkvllfmdpsagiegfep
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3r66B (B:)
    mghhhhhhshmadnmtttqievgpgatnatinfeagilecyerfswqraldypgqdrlhr
    lkrklesrikthnksepenkrmsleerkaigvkmmkvllfmdpsagiegfepy
    

    Sequence, based on observed residues (ATOM records): (download)
    >3r66B (B:)
    ttqievgpgatnatinfeagilecyerfswqraldypgqdrlhrlkrklesrikthnkse
    penkrmsleerkaigvkmmkvllfmdpsagiegfep
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3r66C (C:)
    shhhhhhmgwdltvkmlagnefqvslsssmsvselkaqitqkigvhafqqrlavhpsgva
    lqdrvplasqglgpgstvllvvdkcdeplsilvrnnkgrsstyevrltqtvahlkqqvsg
    legvqddlfwltfegkpledqlplgeyglkplstvfmnlrlrgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3r66C (C:)
    dltvkmlagnefqvslsssmsvselkaqitqkigvhafqqrlavhpsgvalqdrvplasq
    glgpgstvllvvdkcdeplsilvrnnkgrsstyevrltqtvahlkqqvsglegvqddlfw
    ltfegkpledqlplgeyglkplstvfmnlrl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3r66D (D:)
    shhhhhhmgwdltvkmlagnefqvslsssmsvselkaqitqkigvhafqqrlavhpsgva
    lqdrvplasqglgpgstvllvvdkcdeplsilvrnnkgrsstyevrltqtvahlkqqvsg
    legvqddlfwltfegkpledqlplgeyglkplstvfmnlrlrgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3r66D (D:)
    dltvkmlagnefqvslsssmsvselkaqitqkigvhafqqrlavhpsgvalqdrvplasq
    glgpgstvllvvdkcdeplsilvrnnkgrsstyevrltqtvahlkqqvsglegvqddlfw
    ltfegkpledqlplgeyglkplstvfmnlrl