SCOPe 2.05: Domain d3qy2b_: 3qy2 B:

Lineage for d3qy2b_ (3qy2 B:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.97: Cell cycle regulatory proteins [55636] (1 superfamily)
   beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1243
   can form strand-exchange dimers

4. Superfamily d.97.1: Cell cycle regulatory proteins [55637] (1 family)

5. Family d.97.1.1: Cell cycle regulatory proteins [55638] (5 proteins)

6. Protein automated matches [227065] (3 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [226163] (1 PDB entry)

8. Domain d3qy2b_: 3qy2 B: [215490]
   automated match to d1qb3a_
   complexed with flc; mutant

Details for d3qy2b_

PDB Entry: 3qy2, 2.59 Å

PDB Description: Crystal structure of the P93A monomer mutant of S. cerevisiae Cks1

PDB Compounds: (B:) cyclin-dependent kinases regulatory subunit

SCOPe Domain Sequences for d3qy2b_:

Sequence; same for both SEQRES and ATOM records:

>d3qy2b_ d.97.1.1 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
afqgrkltdqerarvlefqdsihysprysddnyeyrhvmlpkamlkvipsdyfnsevgtl
riltedewrglgitqslgwehyechaaephillfkrplnyeaelr

Timeline for d3qy2b_:

• d3qy2b_ first appeared in SCOPe 2.03
  
• d3qy2b_ appears in SCOPe 2.04
  
• d3qy2b_ appears in SCOPe 2.06
  
• d3qy2b_ appears in the current release, SCOPe 2.08