Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.97: Cell cycle regulatory proteins [55636] (1 superfamily) beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1243 can form strand-exchange dimers |
Superfamily d.97.1: Cell cycle regulatory proteins [55637] (1 family) |
Family d.97.1.1: Cell cycle regulatory proteins [55638] (5 proteins) |
Protein automated matches [227065] (3 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [226163] (1 PDB entry) |
Domain d3qy2b_: 3qy2 B: [215490] automated match to d1qb3a_ complexed with flc; mutant |
PDB Entry: 3qy2 (more details), 2.59 Å
SCOPe Domain Sequences for d3qy2b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3qy2b_ d.97.1.1 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} afqgrkltdqerarvlefqdsihysprysddnyeyrhvmlpkamlkvipsdyfnsevgtl riltedewrglgitqslgwehyechaaephillfkrplnyeaelr
Timeline for d3qy2b_: