Lineage for d3qy2b_ (3qy2 B:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2532037Fold d.97: Cell cycle regulatory proteins [55636] (1 superfamily)
    beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1243
    can form strand-exchange dimers
  4. 2532038Superfamily d.97.1: Cell cycle regulatory proteins [55637] (1 family) (S)
  5. 2532039Family d.97.1.1: Cell cycle regulatory proteins [55638] (5 proteins)
  6. 2532066Protein automated matches [227065] (4 species)
    not a true protein
  7. 2532067Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [226163] (1 PDB entry)
  8. 2532069Domain d3qy2b_: 3qy2 B: [215490]
    automated match to d1qb3a_
    complexed with flc; mutant

Details for d3qy2b_

PDB Entry: 3qy2 (more details), 2.59 Å

PDB Description: Crystal structure of the P93A monomer mutant of S. cerevisiae Cks1
PDB Compounds: (B:) cyclin-dependent kinases regulatory subunit

SCOPe Domain Sequences for d3qy2b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qy2b_ d.97.1.1 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
afqgrkltdqerarvlefqdsihysprysddnyeyrhvmlpkamlkvipsdyfnsevgtl
riltedewrglgitqslgwehyechaaephillfkrplnyeaelr

SCOPe Domain Coordinates for d3qy2b_:

Click to download the PDB-style file with coordinates for d3qy2b_.
(The format of our PDB-style files is described here.)

Timeline for d3qy2b_: