Lineage for d3qopb2 (3qop B:138-207)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1981563Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1982668Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1982714Family a.4.5.4: CAP C-terminal domain-like [46796] (9 proteins)
  6. 1982715Protein Catabolite gene activator protein (CAP), C-terminal domain [46797] (1 species)
    N-terminal domain has double beta-helix fold
  7. 1982716Species Escherichia coli [TaxId:562] [46798] (27 PDB entries)
  8. 1982720Domain d3qopb2: 3qop B:138-207 [215335]
    Other proteins in same PDB: d3qopa1, d3qopb1
    automated match to d1i5za1
    complexed with cmp, gol

Details for d3qopb2

PDB Entry: 3qop (more details), 1.96 Å

PDB Description: domain-domain flexibility leads to allostery within the camp receptor protein (crp)
PDB Compounds: (B:) Catabolite gene activator

SCOPe Domain Sequences for d3qopb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qopb2 a.4.5.4 (B:138-207) Catabolite gene activator protein (CAP), C-terminal domain {Escherichia coli [TaxId: 562]}
dvtgriaqtllnlakqpdamthpdgmqikitrqeigqivgcsretvgrilkmledqnlis
ahgktivvyg

SCOPe Domain Coordinates for d3qopb2:

Click to download the PDB-style file with coordinates for d3qopb2.
(The format of our PDB-style files is described here.)

Timeline for d3qopb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3qopb1