SCOPe 2.08: Domain d3qopb2: 3qop B:138-207

Lineage for d3qopb2 (3qop B:138-207)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.4: CAP C-terminal domain-like [46796] (9 proteins)

6. Protein Catabolite gene activator protein (CAP), C-terminal domain [46797] (1 species)
   N-terminal domain has double beta-helix fold

7. Species Escherichia coli [TaxId:562] [46798] (28 PDB entries)

8. Domain d3qopb2: 3qop B:138-207 [215335]
   Other proteins in same PDB: d3qopa1, d3qopb1
   automated match to d1i5za1
   complexed with cmp, gol

Details for d3qopb2

PDB Entry: 3qop, 1.96 Å

PDB Description: domain-domain flexibility leads to allostery within the camp receptor protein (crp)

PDB Compounds: (B:) Catabolite gene activator

SCOPe Domain Sequences for d3qopb2:

Sequence; same for both SEQRES and ATOM records:

>d3qopb2 a.4.5.4 (B:138-207) Catabolite gene activator protein (CAP), C-terminal domain {Escherichia coli [TaxId: 562]}
dvtgriaqtllnlakqpdamthpdgmqikitrqeigqivgcsretvgrilkmledqnlis
ahgktivvyg

Timeline for d3qopb2:

• d3qopb2 first appeared in SCOPe 2.03
  
• d3qopb2 appears in SCOPe 2.07