Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) |
Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins) members of the family may contain various insert subdomains in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain |
Protein automated matches [190099] (19 species) not a true protein |
Species Pyrococcus woesei [TaxId:2262] [226292] (1 PDB entry) |
Domain d3qgva1: 3qgv A:1-361 [215224] Other proteins in same PDB: d3qgva2 automated match to d1mxga2 complexed with bcd, ca, so4, suc, trs, zn |
PDB Entry: 3qgv (more details), 2.1 Å
SCOPe Domain Sequences for d3qgva1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3qgva1 c.1.8.1 (A:1-361) automated matches {Pyrococcus woesei [TaxId: 2262]} akyselekggvimqafywdvpsggiwwdtirqkipewydagisaiwippaskgmggaysm gydpydffdlgeydqkgtvetrfgskqelvnmintahaygmkviadivinhraggdlewn pfvndytwtdfskvasgkytanyldfhpnelhagdsgtfggypdichdkswdqywlwasq esyaaylrsigidawrfdyvkgyapwvvkdwlnwwggwavgeywdtnvdavlnwayssga kvfdfalyykmdeafdnknipalvsalqngqtvvsrdpfkavtfvanhdtdiiwnkypay afiltyegqptifyrdyeewlnkdklknliwihenlaggstdivyydndelifvrngygd k
Timeline for d3qgva1: