SCOPe 2.04: Domain d3qgva2: 3qgv A:362-435

Lineage for d3qgva2 (3qgv A:362-435)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.0: automated matches [227134] (1 protein)
   not a true family

6. Protein automated matches [226835] (27 species)
   not a true protein

7. Species Pyrococcus woesei [TaxId:2262] [226293] (1 PDB entry)

8. Domain d3qgva2: 3qgv A:362-435 [215225]
   Other proteins in same PDB: d3qgva1
   automated match to d1mwoa1
   complexed with bcd, ca, so4, suc, trs, zn

Details for d3qgva2

PDB Entry: 3qgv, 2.1 Å

PDB Description: crystal structure of a thermostable amylase variant

PDB Compounds: (A:) alpha amylase

SCOPe Domain Sequences for d3qgva2:

Sequence; same for both SEQRES and ATOM records:

>d3qgva2 b.71.1.0 (A:362-435) automated matches {Pyrococcus woesei [TaxId: 2262]}
pglityinlgsskagrwvyvpkfagaciheytgnlggwvdkyvyssgwvyleapaydpan
gqygysvwsycgvg

Timeline for d3qgva2:

• d3qgva2 first appeared in SCOPe 2.03
  
• d3qgva2 appears in SCOPe 2.05
  
• d3qgva2 appears in the current release, SCOPe 2.08