Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.17: Nicotinate/Quinolinate PRTase C-terminal domain-like [51690] (3 families) incomplete beta/alpha barrel with parallel beta-sheet of 7 strands |
Family c.1.17.0: automated matches [227169] (1 protein) not a true family |
Protein automated matches [226879] (8 species) not a true protein |
Species Vibrio cholerae [TaxId:243277] [226021] (2 PDB entries) |
Domain d3pajb2: 3paj B:129-294 [214739] Other proteins in same PDB: d3paja1, d3paja3, d3pajb1, d3pajb3 automated match to d1qapa1 complexed with mg |
PDB Entry: 3paj (more details), 2 Å
SCOPe Domain Sequences for d3pajb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3pajb2 c.1.17.0 (B:129-294) automated matches {Vibrio cholerae [TaxId: 243277]} catataryvqelkgtqcrlldtrktipglrsalkyavacgggynhrigvfdaylikenhi iacggirqaistakqlnpgkpvevetetlaeleeaisagadiimldnfslemmreavkin agraalensgnitldnlkecaetgvdyisvgaltkhlkaldlsmrf
Timeline for d3pajb2: