SCOPe 2.05: Domain d3pajb2: 3paj B:129-294

Lineage for d3pajb2 (3paj B:129-294)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.17: Nicotinate/Quinolinate PRTase C-terminal domain-like [51690] (3 families)
   incomplete beta/alpha barrel with parallel beta-sheet of 7 strands

5. Family c.1.17.0: automated matches [227169] (1 protein)
   not a true family

6. Protein automated matches [226879] (6 species)
   not a true protein

7. Species Vibrio cholerae [TaxId:243277] [226021] (2 PDB entries)

8. Domain d3pajb2: 3paj B:129-294 [214739]
   Other proteins in same PDB: d3paja1, d3pajb1
   automated match to d1qapa1
   complexed with mg

Details for d3pajb2

PDB Entry: 3paj, 2 Å

PDB Description: 2.00 angstrom resolution crystal structure of a quinolinate phosphoribosyltransferase from vibrio cholerae o1 biovar eltor str. n16961

PDB Compounds: (B:) Nicotinate-nucleotide pyrophosphorylase, carboxylating

SCOPe Domain Sequences for d3pajb2:

Sequence; same for both SEQRES and ATOM records:

>d3pajb2 c.1.17.0 (B:129-294) automated matches {Vibrio cholerae [TaxId: 243277]}
catataryvqelkgtqcrlldtrktipglrsalkyavacgggynhrigvfdaylikenhi
iacggirqaistakqlnpgkpvevetetlaeleeaisagadiimldnfslemmreavkin
agraalensgnitldnlkecaetgvdyisvgaltkhlkaldlsmrf

Timeline for d3pajb2:

• d3pajb2 first appeared in SCOPe 2.03
  
• d3pajb2 appears in SCOPe 2.04
  
• d3pajb2 appears in SCOPe 2.06
  
• d3pajb2 appears in the current release, SCOPe 2.08