Class b: All beta proteins [48724] (144 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
Protein Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma [88584] (4 species) |
Species Human (Homo sapiens) [TaxId:9606] [88585] (22 PDB entries) |
Domain d1mcoh3: 1mco H:220-327 [21470] Other proteins in same PDB: d1mcoh1, d1mcoh2, d1mcoh4, d1mcol1, d1mcol2 part of intact antibody MCG |
PDB Entry: 1mco (more details), 3.2 Å
SCOP Domain Sequences for d1mcoh3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mcoh3 b.1.1.2 (H:220-327) Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma {Human (Homo sapiens)} lggpsvflfppkpkdtlmisrtpevtcvvvdvshedpqvkfnwyvdgvqvhnaktkpreq qynstyrvvsvltvlhqnwldgkeykckvsnkalpapiektiskakgq
Timeline for d1mcoh3: