Lineage for d1mcoh3 (1mco H:220-327)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 8163Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 8462Protein Immunoglobulin (constant domains of L and H chains) [48972] (152 species)
  7. 9202Species Intact antibody (lambda) MCG (human) [49116] (1 PDB entry)
  8. 9204Domain d1mcoh3: 1mco H:220-327 [21470]
    Other proteins in same PDB: d1mcoh1, d1mcol1

Details for d1mcoh3

PDB Entry: 1mco (more details), 3.2 Å

PDB Description: three-dimensional structure of a human immunoglobulin with a hinge deletion

SCOP Domain Sequences for d1mcoh3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mcoh3 b.1.1.2 (H:220-327) Immunoglobulin (constant domains of L and H chains) {Intact antibody (lambda) MCG (human)}
lggpsvflfppkpkdtlmisrtpevtcvvvdvshedpqvkfnwyvdgvqvhnaktkpreq
qynstyrvvsvltvlhqnwldgkeykckvsnkalpapiektiskakgq

SCOP Domain Coordinates for d1mcoh3:

Click to download the PDB-style file with coordinates for d1mcoh3.
(The format of our PDB-style files is described here.)

Timeline for d1mcoh3: