Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) |
Family d.54.1.0: automated matches [227195] (1 protein) not a true family |
Protein automated matches [226922] (88 species) not a true protein |
Species Toxoplasma gondii [TaxId:508771] [225974] (1 PDB entry) |
Domain d3otrc1: 3otr C:1-147 [214545] Other proteins in same PDB: d3otra2, d3otrb2, d3otrb3, d3otrc2, d3otrc3, d3otrd2, d3otrd3, d3otre2, d3otre3, d3otrf2, d3otrf3 automated match to d1pdza2 complexed with cl, so4 |
PDB Entry: 3otr (more details), 2.75 Å
SCOPe Domain Sequences for d3otrc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3otrc1 d.54.1.0 (C:1-147) automated matches {Toxoplasma gondii [TaxId: 508771]} mvvikdivareildsrgnptievdvsteggvfraavpsgastgiyealelrdkdpkrylg kgvlnaveivrqeikpallgkdpcdqkgidmlmveqldgtknewgysksklganailgvs iaccragaaskglplykyiatlagkti
Timeline for d3otrc1: