Lineage for d3otrb1 (3otr B:1-147)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2191243Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 2191244Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 2191540Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 2191541Protein automated matches [226922] (88 species)
    not a true protein
  7. 2192267Species Toxoplasma gondii [TaxId:508771] [225974] (1 PDB entry)
  8. 2192269Domain d3otrb1: 3otr B:1-147 [214543]
    Other proteins in same PDB: d3otra2, d3otrb2, d3otrb3, d3otrc2, d3otrc3, d3otrd2, d3otrd3, d3otre2, d3otre3, d3otrf2, d3otrf3
    automated match to d1pdza2
    complexed with cl, so4

Details for d3otrb1

PDB Entry: 3otr (more details), 2.75 Å

PDB Description: 2.75 angstrom crystal structure of enolase 1 from toxoplasma gondii
PDB Compounds: (B:) enolase

SCOPe Domain Sequences for d3otrb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3otrb1 d.54.1.0 (B:1-147) automated matches {Toxoplasma gondii [TaxId: 508771]}
mvvikdivareildsrgnptievdvsteggvfraavpsgastgiyealelrdkdpkrylg
kgvlnaveivrqeikpallgkdpcdqkgidmlmveqldgtknewgysksklganailgvs
iaccragaaskglplykyiatlagkti

SCOPe Domain Coordinates for d3otrb1:

Click to download the PDB-style file with coordinates for d3otrb1.
(The format of our PDB-style files is described here.)

Timeline for d3otrb1: