Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein automated matches [190374] (12 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [224855] (237 PDB entries) |
Domain d3o2dl2: 3o2d L:107-210 [214127] Other proteins in same PDB: d3o2da1, d3o2da2, d3o2dl1 automated match to d1rhha2 |
PDB Entry: 3o2d (more details), 2.19 Å
SCOPe Domain Sequences for d3o2dl2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3o2dl2 b.1.1.2 (L:107-210) automated matches {Mouse (Mus musculus) [TaxId: 10090]} rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd skdstyslsstltlskadyekhkvyacevthqglsspvtksfnr
Timeline for d3o2dl2: