SCOPe 2.03: Domain d3o2da2: 3o2d A:98-178

Lineage for d3o2da2 (3o2d A:98-178)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.3: C2 set domains [49142] (8 proteins)

6. Protein CD4 C2-set domains [49149] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49150] (29 PDB entries)

8. Domain d3o2da2: 3o2d A:98-178 [233060]
   Other proteins in same PDB: d3o2da1, d3o2dl1, d3o2dl2
   automated match to d1cdya2

Details for d3o2da2

PDB Entry: 3o2d, 2.19 Å

PDB Description: Crystal structure of HIV-1 primary receptor CD4 in complex with a potent antiviral antibody

PDB Compounds: (A:) T-cell surface glycoprotein cd4

SCOPe Domain Sequences for d3o2da2:

Sequence; same for both SEQRES and ATOM records:

>d3o2da2 b.1.1.3 (A:98-178) CD4 C2-set domains {Human (Homo sapiens) [TaxId: 9606]}
fgltansdthllqgqsltltlesppgsspsvqcrsprgkniqggktlsvsqlelqdsgtw
tctvlqnqkkvefkidivvla

Timeline for d3o2da2:

• d3o2da2 is new in SCOPe 2.03-stable
  
• d3o2da2 appears in SCOPe 2.04
  
• d3o2da2 appears in the current release, SCOPe 2.08